PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 68150
Common NameSELMODRAFT_58190, SELMODRAFT_68150
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella
Family NAC
Protein Properties Length: 129aa    MW: 15159 Da    PI: 9.5464
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
68150genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM180.73.7e-5611252128
    NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvglkkt 105
            ppGfrF+Ptd+elv +yL++kv+g+++++ ++i+evd+yk+ePwdLp k + ++ ewyfFs+rd+ky++g r+nrat++gyWkatgkd++v s +++++g+kkt
  68150   1 PPGFRFRPTDQELVGFYLARKVSGRSIQA-NIIAEVDLYKCEPWDLPGKSYVTDVEWYFFSPRDRKYPNGWRTNRATEAGYWKATGKDRTVRS-GSRDIGMKKT 102
            89***************************.89***************87788899*************************************9.99******** PP

    NAM 106 LvfykgrapkgektdWvmheyrl 128
            Lvfy+grap+g++tdW+mheyrl
  68150 103 LVFYTGRAPHGQRTDWIMHEYRL 125
            *********************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100556.0741129IPR003441NAC domain
PfamPF023653.5E-301125IPR003441NAC domain
SuperFamilySSF1019412.35E-591128IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 129 aa     Download sequence    Send to blast
PPGFRFRPTD QELVGFYLAR KVSGRSIQAN IIAEVDLYKC EPWDLPGKSY VTDVEWYFFS  60
PRDRKYPNGW RTNRATEAGY WKATGKDRTV RSGSRDIGMK KTLVFYTGRA PHGQRTDWIM  120
HEYRLDEDD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A9e-54112516140Stress-induced transcription factor NAC1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00212DAPTransfer from AT1G65910Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002961864.15e-93hypothetical protein SELMODRAFT_68150, partial
RefseqXP_002980786.15e-93hypothetical protein SELMODRAFT_58190, partial
SwissprotQ9FFI52e-65NAC86_ARATH; NAC domain-containing protein 86
TrEMBLD8QTJ05e-93D8QTJ0_SELML; Putative uncharacterized protein (Fragment)
STRINGEFJ179711e-92(Selaginella moellendorffii)
STRINGEFJ371241e-92(Selaginella moellendorffii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1715800
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G65910.12e-70NAC domain containing protein 28
Publications ? help Back to Top
  1. Banks JA, et al.
    The Selaginella genome identifies genetic changes associated with the evolution of vascular plants.
    Science, 2011. 332(6032): p. 960-3
    [PMID:21551031]